PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015903109.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 588aa    MW: 65891.5 Da    PI: 4.7545
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015903109.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.66.7e-1362195882374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lLl+cA a+s+g+ e+a  ++++l++l+s +gdp qR+aay++e+Laar+a s++ lykal+++e +   s+++laa+++++ev+P++kf+++
  XP_015903109.1 219 RRLLLDCAGAISEGNIEEALMMINELRQLVSIQGDPPQRIAAYMVEGLAARMAASGKFLYKALKCKEPP---STDRLAAMQILFEVCPCFKFGFM 310
                     589*****************************************************************9...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     taN aI ea++ e+rvHiiDfdi+qG Q+++Llq+La+ p++p +lR+Tgv++pes+  s   l+ +g+rL+k+Ae l+vpfef++ v +r++ +
  XP_015903109.1 311 TANGAIIEAFKDEKRVHIIDFDINQGSQYITLLQTLANEPGKPSRLRLTGVDDPESVqrSVGGLKMIGQRLEKLAEVLEVPFEFEA-VPSRTSLV 404
                     *******************************************************9989999************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++++L++kpgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v++veq++++n+++F+ rf+ea +yysa+fdsl+a+lpres++r++
  XP_015903109.1 405 TPSMLNLKPGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTIVEQDVNTNTAPFFPRFVEAYNYYSAVFDSLDATLPRESQDRMN 499
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     vEr++l+r+ivn+vaceg+er+er e ++kWr+r+ +aGF++ p+s+++ + ++  +r++ ++ y+v++e g+l +gW+d++L+++SaWr
  XP_015903109.1 500 VERQCLARDIVNIVACEGEERIERYEVAGKWRARMAMAGFTSCPMSTNVIDLIRKQIRQYCDR-YKVKQEVGALHFGWEDKTLIVASAWR 588
                     *************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.346192569IPR005202Transcription factor GRAS
PfamPF035142.3E-133219588IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MSLVRPAELS ATAYRNPKLY SLKGSNDGSG LSTQVFGSDK RKTMYVTDSY CTESYEKYFV  60
DSPSDEVLQP SCSSISGISS NNPEGPSCYQ LRTGSVSPLT PQNPYSASIV SMRHRDAYKS  120
NFESDHLESQ SPNLGEFDEN KMRLKLQELE RALLDDNDDE DEEDMFGSGQ SMEVDGDWVD  180
PVQNEMLHDS PKESSSSDSN ISSISSSKEM SQVSPRTPRR LLLDCAGAIS EGNIEEALMM  240
INELRQLVSI QGDPPQRIAA YMVEGLAARM AASGKFLYKA LKCKEPPSTD RLAAMQILFE  300
VCPCFKFGFM TANGAIIEAF KDEKRVHIID FDINQGSQYI TLLQTLANEP GKPSRLRLTG  360
VDDPESVQRS VGGLKMIGQR LEKLAEVLEV PFEFEAVPSR TSLVTPSMLN LKPGEALIVN  420
FAFQLHHMPD ESVSTVNQRD QLLRMVKSLN PKLVTIVEQD VNTNTAPFFP RFVEAYNYYS  480
AVFDSLDATL PRESQDRMNV ERQCLARDIV NIVACEGEER IERYEVAGKW RARMAMAGFT  540
SCPMSTNVID LIRKQIRQYC DRYKVKQEVG ALHFGWEDKT LIVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-5524158826375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015903110.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903109.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903107.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903106.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903105.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903104.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903103.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLW9RNG00.0W9RNG0_9R
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1